PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna23946.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 540aa    MW: 58612.4 Da    PI: 6.077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna23946.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-164087148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed +l ++vk++G g+W+++ +  g+ R++k+c++rw ++l
  mrna23946.1-v1.0-hybrid 40 KGPWTAAEDSILMEYVKKHGEGNWNAVQKNSGLARCGKSCRLRWANHL 87
                             79******************************************9986 PP

2Myb_DNA-binding47.54e-1593136146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g+ T+eE+ +++++++++G++ W++ a+ ++ gRt++++k++w++
  mrna23946.1-v1.0-hybrid  93 KGSLTAEEERIIIELHAKYGNK-WARMASQLP-GRTDNEIKNYWNT 136
                              6788******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5273587IPR017930Myb domain
SuperFamilySSF466895.24E-3037134IPR009057Homeodomain-like
SMARTSM007172.0E-133989IPR001005SANT/Myb domain
PfamPF002494.9E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-234194IPR009057Homeodomain-like
CDDcd001673.94E-114287No hitNo description
PROSITE profilePS5129425.83488142IPR017930Myb domain
SMARTSM007178.2E-1692140IPR001005SANT/Myb domain
PfamPF002497.0E-1493136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2495141IPR009057Homeodomain-like
CDDcd001675.34E-1297136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MIMSHSGDGS MDLSEMVAAA SQLGCGGHHQ LHQPLRGLKK GPWTAAEDSI LMEYVKKHGE  60
GNWNAVQKNS GLARCGKSCR LRWANHLRPN LKKGSLTAEE ERIIIELHAK YGNKWARMAS  120
QLPGRTDNEI KNYWNTRMKR RQRAGLPIYP HELQHEGATA PFHHQQAHHH QQQRHNSNLS  180
SSFSSLLCSS HPRKANYSST PSLSLYDHTS FDAPLQNHHN SPSLNYSNPA MTAQFNANGG  240
FAIPLSPVSP VSPFGSSSSA LFNQTTFPNQ TVLSTPSQYY NSGLGGFGNY STLTHSSMIM  300
GTPTYEPMNS ELPSNQTTPP YSPYTPTKPA SSSANFNGGE GVMEAASGNT NGYEIETVTS  360
LGKRGSGLLD DVLVQAGTLS RNKRSRSGDS SSGESGKDKY IVEEDVESAG EEEEEDNVQE  420
ESTWKSSGEN SAENLRDGSS SPSVGMKPSE DPLEDMDDDL LSLLNFQNSA PVSESWYVGS  480
ISDQASPGMI GASDINVSLD VQQNTSTYAS TVNMSAAKPD VEIKRSLPPC FWNNMPDIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289172.10.0PREDICTED: transcription factor GAMYB
TrEMBLM5XAE21e-146M5XAE2_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-76myb domain protein 101